Lineage for d4acfa2 (4acf A:105-478)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538589Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2538590Protein automated matches [227028] (6 species)
    not a true protein
  7. 2538656Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)
  8. 2538657Domain d4acfa2: 4acf A:105-478 [218783]
    Other proteins in same PDB: d4acfa1, d4acfb1, d4acfc1, d4acfd1, d4acfe1, d4acff1
    automated match to d1f52a2
    complexed with 46b, cl, mg, p3s, po4

Details for d4acfa2

PDB Entry: 4acf (more details), 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
PDB Compounds: (A:) glutamine synthetase 1

SCOPe Domain Sequences for d4acfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acfa2 d.128.1.0 (A:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d4acfa2:

Click to download the PDB-style file with coordinates for d4acfa2.
(The format of our PDB-style files is described here.)

Timeline for d4acfa2: