Lineage for d4ac0a2 (4ac0 A:68-203)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011929Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. 2011930Protein automated matches [226967] (5 species)
    not a true protein
  7. 2011936Species Escherichia coli [TaxId:562] [226545] (1 PDB entry)
  8. 2011937Domain d4ac0a2: 4ac0 A:68-203 [218777]
    Other proteins in same PDB: d4ac0a1
    automated match to d1qpia2
    complexed with mg, miy, po4

Details for d4ac0a2

PDB Entry: 4ac0 (more details), 2.45 Å

PDB Description: tetr(b) in complex with minocycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn1 0

SCOPe Domain Sequences for d4ac0a2:

Sequence, based on SEQRES records: (download)

>d4ac0a2 a.121.1.0 (A:68-203) automated matches {Escherichia coli [TaxId: 562]}
cplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflcqqgfsl
enalyalsavghftlgcvledqehqvakeeretpttdsmppllrqaielfdhqgaepafl
fgleliicglekqlkc

Sequence, based on observed residues (ATOM records): (download)

>d4ac0a2 a.121.1.0 (A:68-203) automated matches {Escherichia coli [TaxId: 562]}
cplegeswqdflrnnaksfrcallshrdgakvhlgtrptekqyetlenqlaflcqqgfsl
enalyalsavghftlgcvledqehqvakeeresmppllrqaielfdhqgaepaflfglel
iicglekqlkc

SCOPe Domain Coordinates for d4ac0a2:

Click to download the PDB-style file with coordinates for d4ac0a2.
(The format of our PDB-style files is described here.)

Timeline for d4ac0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ac0a1