![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (22 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [226228] (11 PDB entries) |
![]() | Domain d4ac0a1: 4ac0 A:2-67 [218776] Other proteins in same PDB: d4ac0a2 automated match to d1qpia1 complexed with mg, miy, po4 |
PDB Entry: 4ac0 (more details), 2.45 Å
SCOPe Domain Sequences for d4ac0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ac0a1 a.4.1.0 (A:2-67) automated matches {Escherichia coli [TaxId: 562]} srldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemld rhhthf
Timeline for d4ac0a1: