Lineage for d4ac0a1 (4ac0 A:2-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692752Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)
  8. 2692764Domain d4ac0a1: 4ac0 A:2-67 [218776]
    Other proteins in same PDB: d4ac0a2
    automated match to d1qpia1
    complexed with mg, miy, po4

Details for d4ac0a1

PDB Entry: 4ac0 (more details), 2.45 Å

PDB Description: tetr(b) in complex with minocycline and magnesium
PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn1 0

SCOPe Domain Sequences for d4ac0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac0a1 a.4.1.0 (A:2-67) automated matches {Escherichia coli [TaxId: 562]}
srldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemld
rhhthf

SCOPe Domain Coordinates for d4ac0a1:

Click to download the PDB-style file with coordinates for d4ac0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ac0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ac0a2