Lineage for d4abza2 (4abz A:68-208)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011789Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 2011790Species Escherichia coli [TaxId:562] [48501] (28 PDB entries)
  8. 2011800Domain d4abza2: 4abz A:68-208 [218775]
    Other proteins in same PDB: d4abza1, d4abza3
    automated match to d1bjza2
    complexed with mg, so4, t1c

Details for d4abza2

PDB Entry: 4abz (more details), 1.89 Å

PDB Description: tetr(d) in complex with tigecycline and magnesium
PDB Compounds: (A:) tetracycline repressor class d

SCOPe Domain Sequences for d4abza2:

Sequence, based on SEQRES records: (download)

>d4abza2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d4abza2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtenlppllrealqimdsddgeqaflhgleslirgfe
vqltallqiv

SCOPe Domain Coordinates for d4abza2:

Click to download the PDB-style file with coordinates for d4abza2.
(The format of our PDB-style files is described here.)

Timeline for d4abza2: