Lineage for d1ctn_1 (1ctn 24-132)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105008Protein Chitinase A, N-terminal domain [49233] (1 species)
  7. 105009Species Serratia marcescens [TaxId:615] [49234] (5 PDB entries)
  8. 105014Domain d1ctn_1: 1ctn 24-132 [21876]
    Other proteins in same PDB: d1ctn_2, d1ctn_3

Details for d1ctn_1

PDB Entry: 1ctn (more details), 2.3 Å

PDB Description: crystal structure of a bacterial chitinase at 2.3 angstroms resolution

SCOP Domain Sequences for d1ctn_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctn_1 b.1.1.5 (24-132) Chitinase A, N-terminal domain {Serratia marcescens}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakillng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOP Domain Coordinates for d1ctn_1:

Click to download the PDB-style file with coordinates for d1ctn_1.
(The format of our PDB-style files is described here.)

Timeline for d1ctn_1: