Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Chitinase A, N-terminal domain N [49233] (1 species) precedes the catalytic (beta/alpha)8-barrel domain |
Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries) Uniprot P07254 24-563 |
Domain d1ehna1: 1ehn A:24-132 [21875] Other proteins in same PDB: d1ehna2, d1ehna3 mutant |
PDB Entry: 1ehn (more details), 1.9 Å
SCOPe Domain Sequences for d1ehna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehna1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]} aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad
Timeline for d1ehna1: