SCOPe 2.05: Domain d4a9nc_: 4a9n C:

Lineage for d4a9nc_ (4a9n C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d4a9nc_: 4a9n C: [218740]
   automated match to d3zyub_
   complexed with a9n, dms, edo, so4

Details for d4a9nc_

PDB Entry: 4a9n, 1.85 Å

PDB Description: n-terminal bromodomain of human brd2 with n-cyclopropyl-5-(3,5- dimethyl-1,2-oxazol-4-yl)-2-methylbenzene-1-sulfonamide

PDB Compounds: (C:) bromodomain containing 2

SCOPe Domain Sequences for d4a9nc_:

Sequence; same for both SEQRES and ATOM records:

>d4a9nc_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyyw
aasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq

Timeline for d4a9nc_:

• d4a9nc_ first appeared in SCOPe 2.03
  
• d4a9nc_ appears in SCOPe 2.04
  
• d4a9nc_ appears in SCOPe 2.06
  
• d4a9nc_ appears in the current release, SCOPe 2.08