Lineage for d1eiba1 (1eib A:24-132)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375146Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2375179Protein Chitinase A, N-terminal domain N [49233] (1 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 2375180Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries)
    Uniprot P07254 24-563
  8. 2375182Domain d1eiba1: 1eib A:24-132 [21874]
    Other proteins in same PDB: d1eiba2, d1eiba3
    mutant

Details for d1eiba1

PDB Entry: 1eib (more details), 1.8 Å

PDB Description: crystal structure of chitinase a mutant d313a complexed with octa-n- acetylchitooctaose (nag)8.
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1eiba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiba1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOPe Domain Coordinates for d1eiba1:

Click to download the PDB-style file with coordinates for d1eiba1.
(The format of our PDB-style files is described here.)

Timeline for d1eiba1: