SCOP 1.71: Domain d1hcy_3: 1hcy 399-653

Lineage for d1hcy_3 (1hcy 399-653)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)

6. Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
   elaborated with many loop insertions in the common fold

7. Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (7 PDB entries)

8. Domain d1hcy_3: 1hcy 399-653 [21871]
   Other proteins in same PDB: d1hcy_1, d1hcy_2
   complexed with cu, nag

Details for d1hcy_3

PDB Entry: 1hcy, 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hcy_3:

Sequence, based on SEQRES records:

>d1hcy_3 b.1.18.3 (399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg
vsnikhvvvkivhhl

Sequence, based on observed residues (ATOM records):

>d1hcy_3 b.1.18.3 (399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvv
kivhhl

Timeline for d1hcy_3:

• d1hcy_3 first appeared (with stable ids) in SCOP 1.55
  
• d1hcy_3 appears in SCOP 1.69
  
• d1hcy_3 is called d1hcya3 in SCOP 1.73
  
• d1hcy_3 appears in the current release, SCOPe 2.08, called d1hcya3