Lineage for d1hcy_3 (1hcy 399-653)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 367971Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)
  6. 367972Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
    elaborated with many loop insertions in the common fold
  7. 367978Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (7 PDB entries)
  8. 367985Domain d1hcy_3: 1hcy 399-653 [21871]
    Other proteins in same PDB: d1hcy_1, d1hcy_2
    complexed with cu, nag

Details for d1hcy_3

PDB Entry: 1hcy (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hcy_3:

Sequence, based on SEQRES records: (download)

>d1hcy_3 b.1.18.3 (399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg
vsnikhvvvkivhhl

Sequence, based on observed residues (ATOM records): (download)

>d1hcy_3 b.1.18.3 (399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvv
kivhhl

SCOP Domain Coordinates for d1hcy_3:

Click to download the PDB-style file with coordinates for d1hcy_3.
(The format of our PDB-style files is described here.)

Timeline for d1hcy_3: