Lineage for d1hc1a3 (1hc1 A:399-653)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770535Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)
    automatically mapped to Pfam PF03723
  6. 1770536Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
    elaborated with many loop insertions in the common fold
  7. 1770542Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (2 PDB entries)
  8. 1770543Domain d1hc1a3: 1hc1 A:399-653 [21870]
    Other proteins in same PDB: d1hc1a1, d1hc1a2
    complexed with cu

Details for d1hc1a3

PDB Entry: 1hc1 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
PDB Compounds: (A:) arthropodan hemocyanin

SCOPe Domain Sequences for d1hc1a3:

Sequence, based on SEQRES records: (download)

>d1hc1a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg
vsnikhvvvkivhhl

Sequence, based on observed residues (ATOM records): (download)

>d1hc1a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavnggldlsayerscgipdrmllpkskpegmef
nlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvki
vhhl

SCOPe Domain Coordinates for d1hc1a3:

Click to download the PDB-style file with coordinates for d1hc1a3.
(The format of our PDB-style files is described here.)

Timeline for d1hc1a3: