Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [195071] (2 PDB entries) |
Domain d4a7xf_: 4a7x F: [218699] automated match to d4a7wb_ complexed with udp |
PDB Entry: 4a7x (more details), 2.49 Å
SCOPe Domain Sequences for d4a7xf_:
Sequence, based on SEQRES records: (download)
>d4a7xf_ c.73.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]} nkrvlvkfsgealagdnqfgidihvldhiakeikslvendievgivigggniirgvsaaq ggiirrtsgdymgmlatvinavamqealehigldtrvqsaieikeicesyiyrkairhle kgrvvifgagtgnpffttdtaatlraieigsdliikatkvdgiydkdpnkfkdakkldtl syndaligdievmddtaislakdnklpivvcnmfkkgnllqvikhqqgvfsmvk
>d4a7xf_ c.73.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]} nkrvlvkfsgealagdnqfgidihvldhiakeikslvendievgivigggniirgvsaaq ggiirrtsgdymgmlatvinavamqealehigldtrvqsaieikeicesyiyrkairhle kgrvvifgagtgnpffttdtaatlraieigsdliikatkvdgiydkdkdakkldtlsynd aligdievmddtaislakdnklpivvcnmfkkgnllqvikhqqgvfsmvk
Timeline for d4a7xf_: