Lineage for d1hc3_3 (1hc3 399-653)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54623Protein Hemocyanin, C-terminal domain [49228] (2 species)
  7. 54629Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (7 PDB entries)
  8. 54631Domain d1hc3_3: 1hc3 399-653 [21868]
    Other proteins in same PDB: d1hc3_1, d1hc3_2

Details for d1hc3_3

PDB Entry: 1hc3 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc3_3:

Sequence, based on SEQRES records: (download)

>d1hc3_3 b.1.1.5 (399-653) Hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg
vsnikhvvvkivhhl

Sequence, based on observed residues (ATOM records): (download)

>d1hc3_3 b.1.1.5 (399-653) Hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavnggldlsayerscgipdrmllpkskpegmef
nlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvki
vhhl

SCOP Domain Coordinates for d1hc3_3:

Click to download the PDB-style file with coordinates for d1hc3_3.
(The format of our PDB-style files is described here.)

Timeline for d1hc3_3: