Lineage for d4a6yl2 (4a6y L:111-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518477Domain d4a6yl2: 4a6y L:111-211 [218679]
    Other proteins in same PDB: d4a6yl1
    automated match to d1q0xl2

Details for d4a6yl2

PDB Entry: 4a6y (more details), 2.9 Å

PDB Description: crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3
PDB Compounds: (L:) antibody bbe6.12h3 light chain

SCOPe Domain Sequences for d4a6yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6yl2 b.1.1.2 (L:111-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsr

SCOPe Domain Coordinates for d4a6yl2:

Click to download the PDB-style file with coordinates for d4a6yl2.
(The format of our PDB-style files is described here.)

Timeline for d4a6yl2: