![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein) |
![]() | Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species) elaborated with many loop insertions in the common fold |
![]() | Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (7 PDB entries) |
![]() | Domain d1hc4a3: 1hc4 A:399-653 [21867] Other proteins in same PDB: d1hc4a1, d1hc4a2 complexed with cu |
PDB Entry: 1hc4 (more details), 3.2 Å
SCOP Domain Sequences for d1hc4a3:
Sequence, based on SEQRES records: (download)
>d1hc4a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg vsnikhvvvkivhhl
>d1hc4a3 b.1.18.3 (A:399-653) Arthropod hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet iersskdssvtvpdmpsfqslkeqadnavnggldlsayerscgipdrmllpkskpegmef nlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvki vhhl
Timeline for d1hc4a3: