SCOPe 2.03: Domain d4a5sa2: 4a5s A:509-767

Lineage for d4a5sa2 (4a5s A:509-767)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (40 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (20 PDB entries)

8. Domain d4a5sa2: 4a5s A:509-767 [218664]
   Other proteins in same PDB: d4a5sa1, d4a5sb1
   automated match to d1orva2
   complexed with n7f, nag, so4

Details for d4a5sa2

PDB Entry: 4a5s, 1.62 Å

PDB Description: crystal structure of human dpp4 in complex with a noval heterocyclic dpp4 inhibitor

PDB Compounds: (A:) Dipeptidyl peptidase 4 soluble form

SCOPe Domain Sequences for d4a5sa2:

Sequence; same for both SEQRES and ATOM records:

>d4a5sa2 c.69.1.0 (A:509-767) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslpa

Timeline for d4a5sa2:

• d4a5sa2 is new in SCOPe 2.03-stable
  
• d4a5sa2 appears in SCOPe 2.04
  
• d4a5sa2 appears in the current release, SCOPe 2.08