SCOPe 2.08: Domain d4a5oc1: 4a5o C:2-122

Lineage for d4a5oc1 (4a5o C:2-122)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226249] (1 PDB entry)

8. Domain d4a5oc1: 4a5o C:2-122 [218659]
   Other proteins in same PDB: d4a5oa2, d4a5ob2, d4a5oc2, d4a5od2
   automated match to d1b0aa2
   complexed with gol, peg

Details for d4a5oc1

PDB Entry: 4a5o, 2.2 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD)

PDB Compounds: (C:) Bifunctional protein folD

SCOPe Domain Sequences for d4a5oc1:

Sequence; same for both SEQRES and ATOM records:

>d4a5oc1 c.58.1.0 (C:2-122) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
taqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdceev
gflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdkdvd
g

Timeline for d4a5oc1:

• d4a5oc1 first appeared in SCOPe 2.03
  
• d4a5oc1 appears in SCOPe 2.07