Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (40 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226249] (1 PDB entry) |
Domain d4a5oc1: 4a5o C:2-122 [218659] Other proteins in same PDB: d4a5oa2, d4a5ob2, d4a5oc2, d4a5od2 automated match to d1b0aa2 complexed with gol, peg |
PDB Entry: 4a5o (more details), 2.2 Å
SCOPe Domain Sequences for d4a5oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5oc1 c.58.1.0 (C:2-122) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} taqlidgkaiaanlrqqiaqrvterrqqglrvpglavilvgtdpasqvyvahkrkdceev gflsqaydlpaetsqddllalidrlnddpaidgilvqlplpahldaslllerihpdkdvd g
Timeline for d4a5oc1: