Lineage for d1hc2_3 (1hc2 399-653)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160758Protein Hemocyanin, C-terminal domain [49228] (2 species)
  7. 160764Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [49230] (7 PDB entries)
  8. 160765Domain d1hc2_3: 1hc2 399-653 [21865]
    Other proteins in same PDB: d1hc2_1, d1hc2_2

Details for d1hc2_3

PDB Entry: 1hc2 (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc2_3:

Sequence, based on SEQRES records: (download)

>d1hc2_3 b.1.1.5 (399-653) Hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavngghdldlsayerscgipdrmllpkskpegm
efnlyvavtdgdkdteghngghdyggthaqcgvhgeaypdnrplgyplerripdervidg
vsnikhvvvkivhhl

Sequence, based on observed residues (ATOM records): (download)

>d1hc2_3 b.1.1.5 (399-653) Hemocyanin, C-terminal domain {Spiny lobster (Panulirus interruptus)}
ppythdnlefsgmvvngvaidgelitffdefqyslinavdsgeniedveinarvhrlnhn
eftykitmsnnndgerlatfriflcpiednngitltldearwfcieldkffqkvpsgpet
iersskdssvtvpdmpsfqslkeqadnavnggldlsayerscgipdrmllpkskpegmef
nlyvavtdgdkdteghhaqcgvhgeaypdnrplgyplerripdervidgvsnikhvvvki
vhhl

SCOP Domain Coordinates for d1hc2_3:

Click to download the PDB-style file with coordinates for d1hc2_3.
(The format of our PDB-style files is described here.)

Timeline for d1hc2_3: