Lineage for d4a3rc1 (4a3r C:1-137)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905296Species Bacillus subtilis [TaxId:1423] [226435] (1 PDB entry)
  8. 1905299Domain d4a3rc1: 4a3r C:1-137 [218639]
    Other proteins in same PDB: d4a3ra2, d4a3rb2, d4a3rc2, d4a3rd2
    automated match to d1w6ta2
    complexed with cit, na

Details for d4a3rc1

PDB Entry: 4a3r (more details), 2.2 Å

PDB Description: Crystal structure of Enolase from Bacillus subtilis.
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d4a3rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a3rc1 d.54.1.0 (C:1-137) automated matches {Bacillus subtilis [TaxId: 1423]}
mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
aaadflqiplyqylggf

SCOPe Domain Coordinates for d4a3rc1:

Click to download the PDB-style file with coordinates for d4a3rc1.
(The format of our PDB-style files is described here.)

Timeline for d4a3rc1: