SCOPe 2.08: Domain d4a3rb2: 4a3r B:138-428

Lineage for d4a3rb2 (4a3r B:138-428)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein automated matches [226973] (7 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226436] (1 PDB entry)

8. Domain d4a3rb2: 4a3r B:138-428 [218638]
   Other proteins in same PDB: d4a3ra1, d4a3rb1, d4a3rc1, d4a3rd1
   automated match to d1w6ta1
   complexed with cit, na

Details for d4a3rb2

PDB Entry: 4a3r, 2.2 Å

PDB Description: Crystal structure of Enolase from Bacillus subtilis.

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d4a3rb2:

Sequence; same for both SEQRES and ATOM records:

>d4a3rb2 c.1.11.1 (B:138-428) automated matches {Bacillus subtilis [TaxId: 1423]}
nsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealrmgaqifhslksvlsakg
lntavgdeggfapnlgsneealqtiveaiekagfkpgeevklamdaassefynkedgkyh
lsgegvvktsaemvdwyeelvskypiisiedgldendweghkllterlgkkvqlvgddlf
vtntkklsegikngvgnsilikvnqigtltetfdaiemakragytavishrsgetedsti
adiavatnagqiktgapsrtdrvakynqllriedqlaetaqyhginsfynl

Timeline for d4a3rb2:

• d4a3rb2 first appeared in SCOPe 2.03
  
• d4a3rb2 appears in SCOPe 2.07