Lineage for d4a3rb1 (4a3r B:1-137)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2554857Species Bacillus subtilis [TaxId:1423] [226435] (1 PDB entry)
  8. 2554859Domain d4a3rb1: 4a3r B:1-137 [218637]
    Other proteins in same PDB: d4a3ra2, d4a3rb2, d4a3rc2, d4a3rd2
    automated match to d1w6ta2
    complexed with cit, na

Details for d4a3rb1

PDB Entry: 4a3r (more details), 2.2 Å

PDB Description: Crystal structure of Enolase from Bacillus subtilis.
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d4a3rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a3rb1 d.54.1.0 (B:1-137) automated matches {Bacillus subtilis [TaxId: 1423]}
mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
aaadflqiplyqylggf

SCOPe Domain Coordinates for d4a3rb1:

Click to download the PDB-style file with coordinates for d4a3rb1.
(The format of our PDB-style files is described here.)

Timeline for d4a3rb1: