Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [226435] (1 PDB entry) |
Domain d4a3rb1: 4a3r B:1-137 [218637] Other proteins in same PDB: d4a3ra2, d4a3rb2, d4a3rc2, d4a3rd2 automated match to d1w6ta2 complexed with cit, na |
PDB Entry: 4a3r (more details), 2.2 Å
SCOPe Domain Sequences for d4a3rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a3rb1 d.54.1.0 (B:1-137) automated matches {Bacillus subtilis [TaxId: 1423]} mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar aaadflqiplyqylggf
Timeline for d4a3rb1: