Lineage for d4a2jb_ (4a2j B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1280251Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1281067Protein automated matches [190059] (12 species)
    not a true protein
  7. 1281087Species Human (Homo sapiens) [TaxId:9606] [187214] (121 PDB entries)
  8. 1281138Domain d4a2jb_: 4a2j B: [218634]
    automated match to d2w8ya_
    complexed with as0, so4

Details for d4a2jb_

PDB Entry: 4a2j (more details), 2 Å

PDB Description: pr x-ray structures in agonist conformations reveal two different mechanisms for partial agonism in 11beta-substituted steroids
PDB Compounds: (B:) progesterone receptor

SCOPe Domain Sequences for d4a2jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2jb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

SCOPe Domain Coordinates for d4a2jb_:

Click to download the PDB-style file with coordinates for d4a2jb_.
(The format of our PDB-style files is described here.)

Timeline for d4a2jb_: