SCOPe 2.03: Domain d4a2ja_: 4a2j A:

Lineage for d4a2ja_ (4a2j A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (121 PDB entries)

8. Domain d4a2ja_: 4a2j A: [218633]
   automated match to d2w8ya_
   complexed with as0, so4

Details for d4a2ja_

PDB Entry: 4a2j, 2 Å

PDB Description: pr x-ray structures in agonist conformations reveal two different mechanisms for partial agonism in 11beta-substituted steroids

PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d4a2ja_:

Sequence; same for both SEQRES and ATOM records:

>d4a2ja_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

Timeline for d4a2ja_:

• d4a2ja_ is new in SCOPe 2.03-stable
  
• d4a2ja_ appears in SCOPe 2.04
  
• d4a2ja_ appears in the current release, SCOPe 2.08