SCOPe 2.03: Domain d4a26b2: 4a26 B:125-296

Lineage for d4a26b2 (4a26 B:125-296)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [226237] (1 PDB entry)

8. Domain d4a26b2: 4a26 B:125-296 [218630]
   Other proteins in same PDB: d4a26a1, d4a26b1
   automated match to d1a4ia1
   complexed with cl

Details for d4a26b2

PDB Entry: 4a26, 2.7 Å

PDB Description: The crystal structure of Leishmania major N5,N10- methylenetetrahydrofolate dehydrogenase/cyclohydrolase

PDB Compounds: (B:) putative c-1-tetrahydrofolate synthase, cytoplasmic

SCOPe Domain Sequences for d4a26b2:

Sequence, based on SEQRES records:

>d4a26b2 c.2.1.0 (B:125-296) automated matches {Leishmania major [TaxId: 5664]}
llpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgapvaallm
kenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgttpvpdp
srkdgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalg

Sequence, based on observed residues (ATOM records):

>d4a26b2 c.2.1.0 (B:125-296) automated matches {Leishmania major [TaxId: 5664]}
llpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgapvaallm
kenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgttpvpdp
sgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalg

Timeline for d4a26b2:

• d4a26b2 is new in SCOPe 2.03-stable
  
• d4a26b2 appears in SCOPe 2.04
  
• d4a26b2 appears in the current release, SCOPe 2.08