Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Leishmania major [TaxId:5664] [226237] (1 PDB entry) |
Domain d4a26b2: 4a26 B:125-296 [218630] Other proteins in same PDB: d4a26a1, d4a26b1 automated match to d1a4ia1 complexed with cl |
PDB Entry: 4a26 (more details), 2.7 Å
SCOPe Domain Sequences for d4a26b2:
Sequence, based on SEQRES records: (download)
>d4a26b2 c.2.1.0 (B:125-296) automated matches {Leishmania major [TaxId: 5664]} llpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgapvaallm kenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgttpvpdp srkdgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalg
>d4a26b2 c.2.1.0 (B:125-296) automated matches {Leishmania major [TaxId: 5664]} llpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgapvaallm kenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgttpvpdp sgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalg
Timeline for d4a26b2: