Lineage for d1nol_3 (1nol 380-628)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9683Protein Hemocyanin, C-terminal domain [49228] (2 species)
  7. 9684Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)
  8. 9687Domain d1nol_3: 1nol 380-628 [21863]
    Other proteins in same PDB: d1nol_1, d1nol_2

Details for d1nol_3

PDB Entry: 1nol (more details), 2.4 Å

PDB Description: oxygenated hemocyanin (subunit type ii)

SCOP Domain Sequences for d1nol_3:

Sequence, based on SEQRES records: (download)

>d1nol_3 b.1.1.5 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records): (download)

>d1nol_3 b.1.1.5 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw
dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh
e

SCOP Domain Coordinates for d1nol_3:

Click to download the PDB-style file with coordinates for d1nol_3.
(The format of our PDB-style files is described here.)

Timeline for d1nol_3: