SCOPe 2.04: Domain d4a26a1: 4a26 A:3-124

Lineage for d4a26a1 (4a26 A:3-124)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (21 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [226236] (1 PDB entry)

8. Domain d4a26a1: 4a26 A:3-124 [218627]
   Other proteins in same PDB: d4a26a2, d4a26b2
   automated match to d1a4ia2
   complexed with cl

Details for d4a26a1

PDB Entry: 4a26, 2.7 Å

PDB Description: The crystal structure of Leishmania major N5,N10- methylenetetrahydrofolate dehydrogenase/cyclohydrolase

PDB Compounds: (A:) putative c-1-tetrahydrofolate synthase, cytoplasmic

SCOPe Domain Sequences for d4a26a1:

Sequence; same for both SEQRES and ATOM records:

>d4a26a1 c.58.1.0 (A:3-124) automated matches {Leishmania major [TaxId: 5664]}
saqiidgkaiaaairselkdkvaalrelyggrvpglasiivgqrmdskkyvqlkhkaaae
vgmasfnvelpedisqevlevnveklnndpnchgiivqlplpkhlnenraiekihphkda
da

Timeline for d4a26a1:

• d4a26a1 first appeared in SCOPe 2.03
  
• d4a26a1 appears in SCOPe 2.05
  
• d4a26a1 appears in the current release, SCOPe 2.08