SCOPe 2.08: Domain d3zzyb_: 3zzy B:

Lineage for d3zzyb_ (3zzy B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)

8. Domain d3zzyb_: 3zzy B: [218622]
   automated match to d1sjra_
   protein/RNA complex

Details for d3zzyb_

PDB Entry: 3zzy, 1.4 Å

PDB Description: crystal structure of a raver1 pri3 peptide in complex with polypyrimidine tract binding protein rrm2

PDB Compounds: (B:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d3zzyb_:

Sequence; same for both SEQRES and ATOM records:

>d3zzyb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqhakl
sldgqniynacctlridfskltslnvkynndksrdytrpdlpsg

Timeline for d3zzyb_:

• d3zzyb_ first appeared in SCOPe 2.03
  
• d3zzyb_ appears in SCOPe 2.07