Lineage for d1oxy_3 (1oxy 380-627)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456372Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)
  6. 456373Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
    elaborated with many loop insertions in the common fold
  7. 456374Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)
  8. 456376Domain d1oxy_3: 1oxy 380-627 [21862]
    Other proteins in same PDB: d1oxy_1, d1oxy_2

Details for d1oxy_3

PDB Entry: 1oxy (more details), 2.4 Å

PDB Description: crystallographic analysis of oxygenated and deoxygenated states of arthropod hemocyanin shows unusual differences

SCOP Domain Sequences for d1oxy_3:

Sequence, based on SEQRES records: (download)

>d1oxy_3 b.1.18.3 (380-627) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikakyyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnvagmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfh

Sequence, based on observed residues (ATOM records): (download)

>d1oxy_3 b.1.18.3 (380-627) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhgsikakyyhldhepfsyavn
vqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgkntvvrhsld
ssvtlshqptfedllseycscgwpshllvpkgnvagmeyhlfvmltdwdkdkvdvacvda
vsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh

SCOP Domain Coordinates for d1oxy_3:

Click to download the PDB-style file with coordinates for d1oxy_3.
(The format of our PDB-style files is described here.)

Timeline for d1oxy_3: