Lineage for d1oxy_3 (1oxy 380-627)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9683Protein Hemocyanin, C-terminal domain [49228] (2 species)
  7. 9684Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)
  8. 9686Domain d1oxy_3: 1oxy 380-627 [21862]
    Other proteins in same PDB: d1oxy_1, d1oxy_2

Details for d1oxy_3

PDB Entry: 1oxy (more details), 2.4 Å

PDB Description: crystallographic analysis of oxygenated and deoxygenated states of arthropod hemocyanin shows unusual differences

SCOP Domain Sequences for d1oxy_3:

Sequence, based on SEQRES records: (download)

>d1oxy_3 b.1.1.5 (380-627) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikakyyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnvagmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfh

Sequence, based on observed residues (ATOM records): (download)

>d1oxy_3 b.1.1.5 (380-627) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhgsikakyyhldhepfsyavn
vqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgkntvvrhsld
ssvtlshqptfedllseycscgwpshllvpkgnvagmeyhlfvmltdwdkdkvdvacvda
vsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh

SCOP Domain Coordinates for d1oxy_3:

Click to download the PDB-style file with coordinates for d1oxy_3.
(The format of our PDB-style files is described here.)

Timeline for d1oxy_3: