SCOPe 2.03: Domain d3zznd1: 3zzn D:22-164

Lineage for d3zznd1 (3zzn D:22-164)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [187989] (15 PDB entries)

8. Domain d3zznd1: 3zzn D:22-164 [218615]
   Other proteins in same PDB: d3zzna2, d3zznb2, d3zznc2, d3zznd2
   automated match to d1llda1
   complexed with adp; mutant

Details for d3zznd1

PDB Entry: 3zzn, 2.9 Å

PDB Description: 5-mutant (r79w, r151a, e279a, e299a,e313a) lactate-dehydrogenase from thermus thermophillus

PDB Compounds: (D:) lactate dehydrogenase

SCOPe Domain Sequences for d3zznd1:

Sequence; same for both SEQRES and ATOM records:

>d3zznd1 c.2.1.0 (D:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayalsglppgrvvgsg

Timeline for d3zznd1:

• d3zznd1 is new in SCOPe 2.03-stable
  
• d3zznd1 appears in SCOPe 2.04
  
• d3zznd1 appears in the current release, SCOPe 2.08