Lineage for d3zznc2 (3zzn C:165-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233276Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)
  8. 2233301Domain d3zznc2: 3zzn C:165-331 [218614]
    Other proteins in same PDB: d3zzna1, d3zznb1, d3zznc1, d3zznd1
    automated match to d1llda2
    complexed with adp; mutant

Details for d3zznc2

PDB Entry: 3zzn (more details), 2.9 Å

PDB Description: 5-mutant (r79w, r151a, e279a, e299a,e313a) lactate-dehydrogenase from thermus thermophillus
PDB Compounds: (C:) lactate dehydrogenase

SCOPe Domain Sequences for d3zznc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zznc2 d.162.1.0 (C:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpevag
vlevslslprilgaggvagtvypslspeeraalrrsaeilkeaafalgf

SCOPe Domain Coordinates for d3zznc2:

Click to download the PDB-style file with coordinates for d3zznc2.
(The format of our PDB-style files is described here.)

Timeline for d3zznc2: