Lineage for d3zznb1 (3zzn B:22-164)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351288Species Thermus thermophilus [TaxId:300852] [187989] (15 PDB entries)
  8. 1351329Domain d3zznb1: 3zzn B:22-164 [218611]
    Other proteins in same PDB: d3zzna2, d3zznb2, d3zznc2, d3zznd2
    automated match to d1llda1
    complexed with adp; mutant

Details for d3zznb1

PDB Entry: 3zzn (more details), 2.9 Å

PDB Description: 5-mutant (r79w, r151a, e279a, e299a,e313a) lactate-dehydrogenase from thermus thermophillus
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d3zznb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zznb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayalsglppgrvvgsg

SCOPe Domain Coordinates for d3zznb1:

Click to download the PDB-style file with coordinates for d3zznb1.
(The format of our PDB-style files is described here.)

Timeline for d3zznb1: