![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein) automatically mapped to Pfam PF03723 |
![]() | Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species) elaborated with many loop insertions in the common fold |
![]() | Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries) |
![]() | Domain d1llaa3: 1lla A:380-628 [21861] Other proteins in same PDB: d1llaa1, d1llaa2 complexed with cl, cu, na |
PDB Entry: 1lla (more details), 2.18 Å
SCOPe Domain Sequences for d1llaa3:
Sequence, based on SEQRES records: (download)
>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi kdikikfhe
>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh e
Timeline for d1llaa3: