Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (20 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein) |
Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species) elaborated with many loop insertions in the common fold |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries) |
Domain d1llaa3: 1lla A:380-628 [21861] Other proteins in same PDB: d1llaa1, d1llaa2 complexed with cl, cu, na |
PDB Entry: 1lla (more details), 2.2 Å
SCOP Domain Sequences for d1llaa3:
Sequence, based on SEQRES records: (download)
>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi kdikikfhe
>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh e
Timeline for d1llaa3: