Lineage for d1lla_3 (1lla 380-628)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160758Protein Hemocyanin, C-terminal domain [49228] (2 species)
  7. 160759Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)
  8. 160760Domain d1lla_3: 1lla 380-628 [21861]
    Other proteins in same PDB: d1lla_1, d1lla_2

Details for d1lla_3

PDB Entry: 1lla (more details), 2.2 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation

SCOP Domain Sequences for d1lla_3:

Sequence, based on SEQRES records: (download)

>d1lla_3 b.1.1.5 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records): (download)

>d1lla_3 b.1.1.5 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw
dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh
e

SCOP Domain Coordinates for d1lla_3:

Click to download the PDB-style file with coordinates for d1lla_3.
(The format of our PDB-style files is described here.)

Timeline for d1lla_3: