SCOP 1.57: Domain d1bf2_1: 1bf2 1-162

Lineage for d1bf2_1 (1bf2 1-162)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (24 proteins)

6. Protein Isoamylase, N-terminal domain [49226] (1 species)

7. Species Pseudomonas amyloderamosa [TaxId:32043] [49227] (1 PDB entry)

8. Domain d1bf2_1: 1bf2 1-162 [21860]
   Other proteins in same PDB: d1bf2_2, d1bf2_3

Details for d1bf2_1

PDB Entry: 1bf2, 2 Å

PDB Description: structure of pseudomonas isoamylase

SCOP Domain Sequences for d1bf2_1:

Sequence; same for both SEQRES and ATOM records:

>d1bf2_1 b.1.1.5 (1-162) Isoamylase, N-terminal domain {Pseudomonas amyloderamosa}
ainsmslgasydaqqanitfrvyssqatrivlylysagygvqesatytlspagsgvwavt
vpvssikaagitgavyygyrawgpnwpyasnwgkgsqagfvsdvdangdrfnpnkllldp
yaqevsqdplnpsnqngnvfasgasyrttdsgiyapkgvvlv

Timeline for d1bf2_1:

• d1bf2_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bf2_1 appears in SCOP 1.59
  
• d1bf2_1 appears in the current release, SCOPe 2.08, called d1bf2a1