SCOPe 2.08: Domain d3zyla1: 3zyl A:5-148

Lineage for d3zyla1 (3zyl A:5-148)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226790] (2 PDB entries)

8. Domain d3zyla1: 3zyl A:5-148 [218587]
   Other proteins in same PDB: d3zyla2, d3zylb2
   automated match to d1hx8a2

Details for d3zyla1

PDB Entry: 3zyl, 1.7 Å

PDB Description: structure of a truncated calm (picalm) anth domain

PDB Compounds: (A:) phosphatidylinositol-binding clathrin assembly protein

SCOPe Domain Sequences for d3zyla1:

Sequence; same for both SEQRES and ATOM records:

>d3zyla1 a.118.9.0 (A:5-148) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sltdritaaqhsvtgsavsktvckattheimgpkkkhldyliqctnemnvnipqladslf
erttnsswvvvfkslitthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfi
rrysrylnekavsyrqvafdftkv

Timeline for d3zyla1:

• d3zyla1 first appeared in SCOPe 2.03
  
• d3zyla1 appears in SCOPe 2.07