SCOPe 2.03: Domain d3zxve1: 3zxv E:4-104

Lineage for d3zxve1 (3zxv E:4-104)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)

8. Domain d3zxve1: 3zxv E:4-104 [218578]
   Other proteins in same PDB: d3zxva2, d3zxvb2, d3zxvc2, d3zxvd2, d3zxve2, d3zxvf2
   automated match to d1f52a1
   complexed with cl, mg, mxi, p3s, po4

Details for d3zxve1

PDB Entry: 3zxv, 2.26 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate

PDB Compounds: (E:) glutamine synthetase 1

SCOPe Domain Sequences for d3zxve1:

Sequence; same for both SEQRES and ATOM records:

>d3zxve1 d.15.9.0 (E:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

Timeline for d3zxve1:

• d3zxve1 is new in SCOPe 2.03-stable
  
• d3zxve1 appears in SCOPe 2.04
  
• d3zxve1 appears in the current release, SCOPe 2.08