Lineage for d3zxvc1 (3zxv C:4-104)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2180100Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2180225Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2180226Protein automated matches [226862] (4 species)
    not a true protein
  7. 2180295Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)
  8. 2180310Domain d3zxvc1: 3zxv C:4-104 [218574]
    Other proteins in same PDB: d3zxva2, d3zxvb2, d3zxvc2, d3zxvd2, d3zxve2, d3zxvf2
    automated match to d1f52a1
    complexed with cl, mg, mxi, p3s, po4

Details for d3zxvc1

PDB Entry: 3zxv (more details), 2.26 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate
PDB Compounds: (C:) glutamine synthetase 1

SCOPe Domain Sequences for d3zxvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxvc1 d.15.9.0 (C:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d3zxvc1:

Click to download the PDB-style file with coordinates for d3zxvc1.
(The format of our PDB-style files is described here.)

Timeline for d3zxvc1: