SCOPe 2.08: Domain d3zxvb2: 3zxv B:105-478

Lineage for d3zxvb2 (3zxv B:105-478)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)

8. Domain d3zxvb2: 3zxv B:105-478 [218573]
   Other proteins in same PDB: d3zxva1, d3zxvb1, d3zxvc1, d3zxvd1, d3zxve1, d3zxvf1
   automated match to d1f52a2
   complexed with cl, mg, mxi, p3s, po4

Details for d3zxvb2

PDB Entry: 3zxv, 2.26 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate

PDB Compounds: (B:) glutamine synthetase 1

SCOPe Domain Sequences for d3zxvb2:

Sequence; same for both SEQRES and ATOM records:

>d3zxvb2 d.128.1.0 (B:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

Timeline for d3zxvb2:

• d3zxvb2 first appeared in SCOPe 2.03
  
• d3zxvb2 appears in SCOPe 2.07