SCOPe 2.07: Domain d3zxrc1: 3zxr C:4-104

Lineage for d3zxrc1 (3zxr C:4-104)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)

8. Domain d3zxrc1: 3zxr C:4-104 [218562]
   Other proteins in same PDB: d3zxra2, d3zxrb2, d3zxrc2, d3zxrd2, d3zxre2, d3zxrf2
   automated match to d1f52a1
   complexed with cl, iq1, mg, p3s, po4

Details for d3zxrc1

PDB Entry: 3zxr, 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.

PDB Compounds: (C:) glutamine synthetase 1

SCOPe Domain Sequences for d3zxrc1:

Sequence; same for both SEQRES and ATOM records:

>d3zxrc1 d.15.9.0 (C:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

Timeline for d3zxrc1:

• d3zxrc1 first appeared in SCOPe 2.03
  
• d3zxrc1 appears in SCOPe 2.06
  
• d3zxrc1 appears in the current release, SCOPe 2.08