Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
Protein automated matches [226862] (3 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries) |
Domain d3zxrc1: 3zxr C:4-104 [218562] Other proteins in same PDB: d3zxra2, d3zxrb2, d3zxrc2, d3zxrd2, d3zxre2, d3zxrf2 automated match to d1f52a1 complexed with cl, iq1, mg, p3s, po4 |
PDB Entry: 3zxr (more details), 2.15 Å
SCOPe Domain Sequences for d3zxrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxrc1 d.15.9.0 (C:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs ihesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d3zxrc1: