Lineage for d3zxrb2 (3zxr B:105-478)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581562Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2581563Protein automated matches [227028] (6 species)
    not a true protein
  7. 2581648Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)
  8. 2581674Domain d3zxrb2: 3zxr B:105-478 [218561]
    Other proteins in same PDB: d3zxra1, d3zxrb1, d3zxrc1, d3zxrd1, d3zxre1, d3zxrf1
    automated match to d1f52a2
    complexed with cl, iq1, mg, p3s, po4

Details for d3zxrb2

PDB Entry: 3zxr (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.
PDB Compounds: (B:) glutamine synthetase 1

SCOPe Domain Sequences for d3zxrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxrb2 d.128.1.0 (B:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d3zxrb2:

Click to download the PDB-style file with coordinates for d3zxrb2.
(The format of our PDB-style files is described here.)

Timeline for d3zxrb2: