Lineage for d1bvza1 (1bvz A:1-120)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54646Protein Maltogenic amylase, N-terminal domain [49221] (2 species)
  7. 54647Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (4 PDB entries)
  8. 54648Domain d1bvza1: 1bvz A:1-120 [21856]
    Other proteins in same PDB: d1bvza2, d1bvza3, d1bvzb2, d1bvzb3

Details for d1bvza1

PDB Entry: 1bvz (more details), 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvza1 b.1.1.5 (A:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1bvza1:

Click to download the PDB-style file with coordinates for d1bvza1.
(The format of our PDB-style files is described here.)

Timeline for d1bvza1: