Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Clostridium tetanomorphum [TaxId:1553] [226375] (2 PDB entries) |
Domain d3zvib1: 3zvi B:1-160 [218541] Other proteins in same PDB: d3zvia2, d3zvia3, d3zvib2, d3zvib3 automated match to d1kkoa2 complexed with cl, gol, mg, rop; mutant |
PDB Entry: 3zvi (more details), 1.9 Å
SCOPe Domain Sequences for d3zvib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvib1 d.54.1.0 (B:1-160) automated matches {Clostridium tetanomorphum [TaxId: 1553]} mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt vngnrlhtairygitqaildavaktrkvtmaevirdeynp
Timeline for d3zvib1: