SCOPe 2.03: Domain d3zvib1: 3zvi B:1-160

Lineage for d3zvib1 (3zvi B:1-160)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Clostridium tetanomorphum [TaxId:1553] [226375] (2 PDB entries)

8. Domain d3zvib1: 3zvi B:1-160 [218541]
   Other proteins in same PDB: d3zvia2, d3zvib2
   automated match to d1kkoa2
   complexed with cl, gol, mg, rop; mutant

Details for d3zvib1

PDB Entry: 3zvi, 1.9 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant l384a

PDB Compounds: (B:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvib1:

Sequence; same for both SEQRES and ATOM records:

>d3zvib1 d.54.1.0 (B:1-160) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
vngnrlhtairygitqaildavaktrkvtmaevirdeynp

Timeline for d3zvib1:

• d3zvib1 is new in SCOPe 2.03-stable
  
• d3zvib1 appears in SCOPe 2.04
  
• d3zvib1 appears in the current release, SCOPe 2.08