Lineage for d3zvia2 (3zvi A:161-415)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824059Species Clostridium tetanomorphum [TaxId:1553] [226805] (2 PDB entries)
  8. 1824060Domain d3zvia2: 3zvi A:161-415 [218540]
    Other proteins in same PDB: d3zvia1, d3zvib1
    automated match to d1kkoa1
    complexed with cl, gol, mg, rop; mutant

Details for d3zvia2

PDB Entry: 3zvi (more details), 1.9 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant l384a
PDB Compounds: (A:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvia2 c.1.11.0 (A:161-415) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd
riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved
rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn
iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvaakpgmgvdegmmivkn
emnrvlalvgrrkkl

SCOPe Domain Coordinates for d3zvia2:

Click to download the PDB-style file with coordinates for d3zvia2.
(The format of our PDB-style files is described here.)

Timeline for d3zvia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zvia1