SCOPe 2.03: Domain d1smaa1: 1sma A:1-123

Lineage for d1smaa1 (1sma A:1-123)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermus sp. [TaxId:275] [49222] (2 PDB entries)

8. Domain d1smaa1: 1sma A:1-123 [21854]
   Other proteins in same PDB: d1smaa2, d1smaa3, d1smab2, d1smab3

Details for d1smaa1

PDB Entry: 1sma, 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

PDB Compounds: (A:) maltogenic amylase

SCOPe Domain Sequences for d1smaa1:

Sequence; same for both SEQRES and ATOM records:

>d1smaa1 b.1.18.2 (A:1-123) Maltogenic amylase, N-terminal domain N {Thermus sp. [TaxId: 275]}
mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
hrv

Timeline for d1smaa1:

• d1smaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1smaa1 appears in SCOPe 2.02
  
• d1smaa1 appears in SCOPe 2.04
  
• d1smaa1 appears in the current release, SCOPe 2.08